This site uses cookies to deliver our services and to show you relevant ads and presentations. By clicking on "Accept", you acknowledge that you have read and understand our Cookie Policy , Privacy Policy , and our Terms of Use.

Download Pancreatitis and Pancreatic Cancer in Spanish PowerPoint Presentation

Login   OR  Register

Iframe embed code :

Presentation url :


Description :

Available Pancreatitis and Pancreatic Cancer in Spanish powerpoint presentation for free download which is uploaded by search an active user in belonging ppt presentation Health & Wellness category.

Tags :

Pancreatitis and Pancreatic Cancer in Spanish

Home / Health & Wellness / Health & Wellness Presentations / Pancreatitis and Pancreatic Cancer in Spanish PowerPoint Presentation

Pancreatitis and Pancreatic Cancer in Spanish PowerPoint Presentation

Ppt Presentation Embed Code   Zoom Ppt Presentation

About This Presentation

Description : Available Pancreatitis and Pancreatic Cancer in Spanish powerpoint presentation for free download wh... Read More

Tags : Pancreatitis and Pancreatic Cancer in Spanish

Published on : Feb 24, 2014
Views : 382 | Downloads : 0

Download Now

Share on Social Media


PowerPoint is the world's most popular presentation software which can let you create professional Pancreatitis and Pancreatic Cancer in Spanish powerpoint presentation easily and in no time. This helps you give your presentation on Pancreatitis and Pancreatic Cancer in Spanish in a conference, a school lecture, a business proposal, in a webinar and business and professional representations.

The uploader spent his/her valuable time to create this Pancreatitis and Pancreatic Cancer in Spanish powerpoint presentation slides, to share his/her useful content with the world. This ppt presentation uploaded by onlinesearch in this Health & Wellness category is available for free download,and can be used according to your industries like finance, marketing, education, health and many more. provides a platform to marketers, presenters and educationists along with being the preferred search engine for professional PowerPoint presentations on the Internet to upload their Pancreatitis and Pancreatic Cancer in Spanish ppt presentation slides to help them BUILD THEIR CROWD!!

User Presentation
Related Presentation
Free PowerPoint Templates
Slide 1 - Pancreatitis y cáncer pancreático David C Whitcomb MD Ph.D. Profesor de Medicina, Biología Celular y Fisiología y Genética Humana Jefe, División de Gastroenterología, Hepatología y Nutrición Director, Centro de Ciencias Genómicas Universidad de Pittsburgh
Slide 2 - Pancreatitis y cáncer pancreático David C Whitcomb MD Ph.D. Profesor de Medicina, Biología Celular y Fisiología y Genética Humana Jefe, División de Gastroenterología, Hepatología y Nutrición Director, Centro de Ciencias Genómicas Universidad de Pittsburgh Panorama 1. Origen de la pancreatitis Activación prematura del tripsinógeno 2. Genética de pancreatitis aguda y crónica Tripsinógeno SPINK1 CFTR 3. Cáncer pancreático Ligado a pancreatitis
Slide 3 - Pancreatitis y cáncer pancreático David C Whitcomb MD Ph.D. Profesor de Medicina, Biología Celular y Fisiología y Genética Humana Jefe, División de Gastroenterología, Hepatología y Nutrición Director, Centro de Ciencias Genómicas Universidad de Pittsburgh Panorama 1. Origen de la pancreatitis Activación prematura del tripsinógeno 2. Genética de pancreatitis aguda y crónica Tripsinógeno SPINK1 CFTR 3. Cáncer pancreático Ligado a pancreatitis Anatomía del páncreas
Slide 4 - Pancreatitis y cáncer pancreático David C Whitcomb MD Ph.D. Profesor de Medicina, Biología Celular y Fisiología y Genética Humana Jefe, División de Gastroenterología, Hepatología y Nutrición Director, Centro de Ciencias Genómicas Universidad de Pittsburgh Panorama 1. Origen de la pancreatitis Activación prematura del tripsinógeno 2. Genética de pancreatitis aguda y crónica Tripsinógeno SPINK1 CFTR 3. Cáncer pancreático Ligado a pancreatitis Anatomía del páncreas Histología Ducto Islote Acinis grasa
Slide 5 - Pancreatitis y cáncer pancreático David C Whitcomb MD Ph.D. Profesor de Medicina, Biología Celular y Fisiología y Genética Humana Jefe, División de Gastroenterología, Hepatología y Nutrición Director, Centro de Ciencias Genómicas Universidad de Pittsburgh Panorama 1. Origen de la pancreatitis Activación prematura del tripsinógeno 2. Genética de pancreatitis aguda y crónica Tripsinógeno SPINK1 CFTR 3. Cáncer pancreático Ligado a pancreatitis Anatomía del páncreas Histología Ducto Islote Acinis grasa Pancreatitis Páncreas - un órgano que elabora bicarbonato para neutralizar el ácido gástrico, enzimas para digerir el contenido de los alimentos e insulina para que el cuerpo almacene los nutrientes ingeridos. Pancreatitis aguda - Un agudo y potencialmente mortal enfermedad; se presenta con dolor abdominal severo en la que el páncreas parece digerirse a sí mismo. Generalmente es causada por cálculos biliares, el alcohol o idiopática. Pancreatitis crónica - una cicatrización irreversible del páncreas con la pérdida permanente de la función pancreática que suele causar incesante dolor abdominal. Pancreatitis hereditaria – una forma no usual de pancreatitis aguda o crónica, que se presenta en familias. El riesgo de Ca de páncreas en >50 veces de lo normal. Páncreas
Slide 6 - Pancreatitis y cáncer pancreático David C Whitcomb MD Ph.D. Profesor de Medicina, Biología Celular y Fisiología y Genética Humana Jefe, División de Gastroenterología, Hepatología y Nutrición Director, Centro de Ciencias Genómicas Universidad de Pittsburgh Panorama 1. Origen de la pancreatitis Activación prematura del tripsinógeno 2. Genética de pancreatitis aguda y crónica Tripsinógeno SPINK1 CFTR 3. Cáncer pancreático Ligado a pancreatitis Anatomía del páncreas Histología Ducto Islote Acinis grasa Pancreatitis Páncreas - un órgano que elabora bicarbonato para neutralizar el ácido gástrico, enzimas para digerir el contenido de los alimentos e insulina para que el cuerpo almacene los nutrientes ingeridos. Pancreatitis aguda - Un agudo y potencialmente mortal enfermedad; se presenta con dolor abdominal severo en la que el páncreas parece digerirse a sí mismo. Generalmente es causada por cálculos biliares, el alcohol o idiopática. Pancreatitis crónica - una cicatrización irreversible del páncreas con la pérdida permanente de la función pancreática que suele causar incesante dolor abdominal. Pancreatitis hereditaria – una forma no usual de pancreatitis aguda o crónica, que se presenta en familias. El riesgo de Ca de páncreas en >50 veces de lo normal. Páncreas TC de necrosis pancreática
Slide 7 - Pancreatitis y cáncer pancreático David C Whitcomb MD Ph.D. Profesor de Medicina, Biología Celular y Fisiología y Genética Humana Jefe, División de Gastroenterología, Hepatología y Nutrición Director, Centro de Ciencias Genómicas Universidad de Pittsburgh Panorama 1. Origen de la pancreatitis Activación prematura del tripsinógeno 2. Genética de pancreatitis aguda y crónica Tripsinógeno SPINK1 CFTR 3. Cáncer pancreático Ligado a pancreatitis Anatomía del páncreas Histología Ducto Islote Acinis grasa Pancreatitis Páncreas - un órgano que elabora bicarbonato para neutralizar el ácido gástrico, enzimas para digerir el contenido de los alimentos e insulina para que el cuerpo almacene los nutrientes ingeridos. Pancreatitis aguda - Un agudo y potencialmente mortal enfermedad; se presenta con dolor abdominal severo en la que el páncreas parece digerirse a sí mismo. Generalmente es causada por cálculos biliares, el alcohol o idiopática. Pancreatitis crónica - una cicatrización irreversible del páncreas con la pérdida permanente de la función pancreática que suele causar incesante dolor abdominal. Pancreatitis hereditaria – una forma no usual de pancreatitis aguda o crónica, que se presenta en familias. El riesgo de Ca de páncreas en >50 veces de lo normal. Páncreas TC de necrosis pancreática TC de pancreatitis crónica severa
Slide 8 - Pancreatitis y cáncer pancreático David C Whitcomb MD Ph.D. Profesor de Medicina, Biología Celular y Fisiología y Genética Humana Jefe, División de Gastroenterología, Hepatología y Nutrición Director, Centro de Ciencias Genómicas Universidad de Pittsburgh Panorama 1. Origen de la pancreatitis Activación prematura del tripsinógeno 2. Genética de pancreatitis aguda y crónica Tripsinógeno SPINK1 CFTR 3. Cáncer pancreático Ligado a pancreatitis Anatomía del páncreas Histología Ducto Islote Acinis grasa Pancreatitis Páncreas - un órgano que elabora bicarbonato para neutralizar el ácido gástrico, enzimas para digerir el contenido de los alimentos e insulina para que el cuerpo almacene los nutrientes ingeridos. Pancreatitis aguda - Un agudo y potencialmente mortal enfermedad; se presenta con dolor abdominal severo en la que el páncreas parece digerirse a sí mismo. Generalmente es causada por cálculos biliares, el alcohol o idiopática. Pancreatitis crónica - una cicatrización irreversible del páncreas con la pérdida permanente de la función pancreática que suele causar incesante dolor abdominal. Pancreatitis hereditaria – una forma no usual de pancreatitis aguda o crónica, que se presenta en familias. El riesgo de Ca de páncreas en >50 veces de lo normal. Páncreas TC de necrosis pancreática TC de pancreatitis crónica severa Pancreatitis crónica: 1995 “pancreatitis crónica permanece como un proceso enigmático de patogénesis no clara, curso clínico impredecible y tratamiento no claro” Progresos médicos: Pancreatitis crónica. Volume 332(22) 1 Jun 1995 pp 1482-1490 Michael L Steer, Irving Waxman, Steven Freedman
Slide 9 - Pancreatitis y cáncer pancreático David C Whitcomb MD Ph.D. Profesor de Medicina, Biología Celular y Fisiología y Genética Humana Jefe, División de Gastroenterología, Hepatología y Nutrición Director, Centro de Ciencias Genómicas Universidad de Pittsburgh Panorama 1. Origen de la pancreatitis Activación prematura del tripsinógeno 2. Genética de pancreatitis aguda y crónica Tripsinógeno SPINK1 CFTR 3. Cáncer pancreático Ligado a pancreatitis Anatomía del páncreas Histología Ducto Islote Acinis grasa Pancreatitis Páncreas - un órgano que elabora bicarbonato para neutralizar el ácido gástrico, enzimas para digerir el contenido de los alimentos e insulina para que el cuerpo almacene los nutrientes ingeridos. Pancreatitis aguda - Un agudo y potencialmente mortal enfermedad; se presenta con dolor abdominal severo en la que el páncreas parece digerirse a sí mismo. Generalmente es causada por cálculos biliares, el alcohol o idiopática. Pancreatitis crónica - una cicatrización irreversible del páncreas con la pérdida permanente de la función pancreática que suele causar incesante dolor abdominal. Pancreatitis hereditaria – una forma no usual de pancreatitis aguda o crónica, que se presenta en familias. El riesgo de Ca de páncreas en >50 veces de lo normal. Páncreas TC de necrosis pancreática TC de pancreatitis crónica severa Pancreatitis crónica: 1995 “pancreatitis crónica permanece como un proceso enigmático de patogénesis no clara, curso clínico impredecible y tratamiento no claro” Progresos médicos: Pancreatitis crónica. Volume 332(22) 1 Jun 1995 pp 1482-1490 Michael L Steer, Irving Waxman, Steven Freedman Orígenes de la Pancreatitis Pre-1896: Pancreatitis es una infección 1896: Pancreatitis es auto digestión del páncreas 1996: Pancreatitis hereditaria es causada por mutaciones en el gen del tripsinógeno catiónico (PRSS1)
Slide 10 - Pancreatitis y cáncer pancreático David C Whitcomb MD Ph.D. Profesor de Medicina, Biología Celular y Fisiología y Genética Humana Jefe, División de Gastroenterología, Hepatología y Nutrición Director, Centro de Ciencias Genómicas Universidad de Pittsburgh Panorama 1. Origen de la pancreatitis Activación prematura del tripsinógeno 2. Genética de pancreatitis aguda y crónica Tripsinógeno SPINK1 CFTR 3. Cáncer pancreático Ligado a pancreatitis Anatomía del páncreas Histología Ducto Islote Acinis grasa Pancreatitis Páncreas - un órgano que elabora bicarbonato para neutralizar el ácido gástrico, enzimas para digerir el contenido de los alimentos e insulina para que el cuerpo almacene los nutrientes ingeridos. Pancreatitis aguda - Un agudo y potencialmente mortal enfermedad; se presenta con dolor abdominal severo en la que el páncreas parece digerirse a sí mismo. Generalmente es causada por cálculos biliares, el alcohol o idiopática. Pancreatitis crónica - una cicatrización irreversible del páncreas con la pérdida permanente de la función pancreática que suele causar incesante dolor abdominal. Pancreatitis hereditaria – una forma no usual de pancreatitis aguda o crónica, que se presenta en familias. El riesgo de Ca de páncreas en >50 veces de lo normal. Páncreas TC de necrosis pancreática TC de pancreatitis crónica severa Pancreatitis crónica: 1995 “pancreatitis crónica permanece como un proceso enigmático de patogénesis no clara, curso clínico impredecible y tratamiento no claro” Progresos médicos: Pancreatitis crónica. Volume 332(22) 1 Jun 1995 pp 1482-1490 Michael L Steer, Irving Waxman, Steven Freedman Orígenes de la Pancreatitis Pre-1896: Pancreatitis es una infección 1896: Pancreatitis es auto digestión del páncreas 1996: Pancreatitis hereditaria es causada por mutaciones en el gen del tripsinógeno catiónico (PRSS1) Pancreatitis hereditaria Pancreatitis hereditaria (PH) es una forma no común de pancreatitis aguda y crónica que se presenta en familias. El riesgo de cáncer pancreático es >50 veces lo normal. Aunque la PH es responsible de sólo el 2.3% de los casos de pancreatitis crónica, el estudio de esta enfermedad ha revolucionado el entendimiento de las enfermedades pancreáticas. Pancreas
Slide 11 - Pancreatitis y cáncer pancreático David C Whitcomb MD Ph.D. Profesor de Medicina, Biología Celular y Fisiología y Genética Humana Jefe, División de Gastroenterología, Hepatología y Nutrición Director, Centro de Ciencias Genómicas Universidad de Pittsburgh Panorama 1. Origen de la pancreatitis Activación prematura del tripsinógeno 2. Genética de pancreatitis aguda y crónica Tripsinógeno SPINK1 CFTR 3. Cáncer pancreático Ligado a pancreatitis Anatomía del páncreas Histología Ducto Islote Acinis grasa Pancreatitis Páncreas - un órgano que elabora bicarbonato para neutralizar el ácido gástrico, enzimas para digerir el contenido de los alimentos e insulina para que el cuerpo almacene los nutrientes ingeridos. Pancreatitis aguda - Un agudo y potencialmente mortal enfermedad; se presenta con dolor abdominal severo en la que el páncreas parece digerirse a sí mismo. Generalmente es causada por cálculos biliares, el alcohol o idiopática. Pancreatitis crónica - una cicatrización irreversible del páncreas con la pérdida permanente de la función pancreática que suele causar incesante dolor abdominal. Pancreatitis hereditaria – una forma no usual de pancreatitis aguda o crónica, que se presenta en familias. El riesgo de Ca de páncreas en >50 veces de lo normal. Páncreas TC de necrosis pancreática TC de pancreatitis crónica severa Pancreatitis crónica: 1995 “pancreatitis crónica permanece como un proceso enigmático de patogénesis no clara, curso clínico impredecible y tratamiento no claro” Progresos médicos: Pancreatitis crónica. Volume 332(22) 1 Jun 1995 pp 1482-1490 Michael L Steer, Irving Waxman, Steven Freedman Orígenes de la Pancreatitis Pre-1896: Pancreatitis es una infección 1896: Pancreatitis es auto digestión del páncreas 1996: Pancreatitis hereditaria es causada por mutaciones en el gen del tripsinógeno catiónico (PRSS1) Pancreatitis hereditaria Pancreatitis hereditaria (PH) es una forma no común de pancreatitis aguda y crónica que se presenta en familias. El riesgo de cáncer pancreático es >50 veces lo normal. Aunque la PH es responsible de sólo el 2.3% de los casos de pancreatitis crónica, el estudio de esta enfermedad ha revolucionado el entendimiento de las enfermedades pancreáticas. Pancreas E-mail Estimado Dr.Whitcomb, Hola. Los médicos piensan que tengo pancreatitis hereditaria debido a que mi papá la tuvo también. Yo no sé mucho, sólo que duele mucho la espalda, los costados y el área del estómago (hablo por experiencia). Estuve en el hospital una vez por eso y fue el pero ataque. Si puede enviarme mayor información, realmente lo aprevciaría. Tengo 12 años y mi padre 42. Que tenga un agradable día Dr.Whitcomb
Slide 12 - Pancreatitis y cáncer pancreático David C Whitcomb MD Ph.D. Profesor de Medicina, Biología Celular y Fisiología y Genética Humana Jefe, División de Gastroenterología, Hepatología y Nutrición Director, Centro de Ciencias Genómicas Universidad de Pittsburgh Panorama 1. Origen de la pancreatitis Activación prematura del tripsinógeno 2. Genética de pancreatitis aguda y crónica Tripsinógeno SPINK1 CFTR 3. Cáncer pancreático Ligado a pancreatitis Anatomía del páncreas Histología Ducto Islote Acinis grasa Pancreatitis Páncreas - un órgano que elabora bicarbonato para neutralizar el ácido gástrico, enzimas para digerir el contenido de los alimentos e insulina para que el cuerpo almacene los nutrientes ingeridos. Pancreatitis aguda - Un agudo y potencialmente mortal enfermedad; se presenta con dolor abdominal severo en la que el páncreas parece digerirse a sí mismo. Generalmente es causada por cálculos biliares, el alcohol o idiopática. Pancreatitis crónica - una cicatrización irreversible del páncreas con la pérdida permanente de la función pancreática que suele causar incesante dolor abdominal. Pancreatitis hereditaria – una forma no usual de pancreatitis aguda o crónica, que se presenta en familias. El riesgo de Ca de páncreas en >50 veces de lo normal. Páncreas TC de necrosis pancreática TC de pancreatitis crónica severa Pancreatitis crónica: 1995 “pancreatitis crónica permanece como un proceso enigmático de patogénesis no clara, curso clínico impredecible y tratamiento no claro” Progresos médicos: Pancreatitis crónica. Volume 332(22) 1 Jun 1995 pp 1482-1490 Michael L Steer, Irving Waxman, Steven Freedman Orígenes de la Pancreatitis Pre-1896: Pancreatitis es una infección 1896: Pancreatitis es auto digestión del páncreas 1996: Pancreatitis hereditaria es causada por mutaciones en el gen del tripsinógeno catiónico (PRSS1) Pancreatitis hereditaria Pancreatitis hereditaria (PH) es una forma no común de pancreatitis aguda y crónica que se presenta en familias. El riesgo de cáncer pancreático es >50 veces lo normal. Aunque la PH es responsible de sólo el 2.3% de los casos de pancreatitis crónica, el estudio de esta enfermedad ha revolucionado el entendimiento de las enfermedades pancreáticas. Pancreas E-mail Estimado Dr.Whitcomb, Hola. Los médicos piensan que tengo pancreatitis hereditaria debido a que mi papá la tuvo también. Yo no sé mucho, sólo que duele mucho la espalda, los costados y el área del estómago (hablo por experiencia). Estuve en el hospital una vez por eso y fue el pero ataque. Si puede enviarme mayor información, realmente lo aprevciaría. Tengo 12 años y mi padre 42. Que tenga un agradable día Dr.Whitcomb Parientes con PH sin enlace 7q35 Una gran familia fue identificada por auto-referencia 71 miembros 6 afectados 2 portadores
Slide 13 - Pancreatitis y cáncer pancreático David C Whitcomb MD Ph.D. Profesor de Medicina, Biología Celular y Fisiología y Genética Humana Jefe, División de Gastroenterología, Hepatología y Nutrición Director, Centro de Ciencias Genómicas Universidad de Pittsburgh Panorama 1. Origen de la pancreatitis Activación prematura del tripsinógeno 2. Genética de pancreatitis aguda y crónica Tripsinógeno SPINK1 CFTR 3. Cáncer pancreático Ligado a pancreatitis Anatomía del páncreas Histología Ducto Islote Acinis grasa Pancreatitis Páncreas - un órgano que elabora bicarbonato para neutralizar el ácido gástrico, enzimas para digerir el contenido de los alimentos e insulina para que el cuerpo almacene los nutrientes ingeridos. Pancreatitis aguda - Un agudo y potencialmente mortal enfermedad; se presenta con dolor abdominal severo en la que el páncreas parece digerirse a sí mismo. Generalmente es causada por cálculos biliares, el alcohol o idiopática. Pancreatitis crónica - una cicatrización irreversible del páncreas con la pérdida permanente de la función pancreática que suele causar incesante dolor abdominal. Pancreatitis hereditaria – una forma no usual de pancreatitis aguda o crónica, que se presenta en familias. El riesgo de Ca de páncreas en >50 veces de lo normal. Páncreas TC de necrosis pancreática TC de pancreatitis crónica severa Pancreatitis crónica: 1995 “pancreatitis crónica permanece como un proceso enigmático de patogénesis no clara, curso clínico impredecible y tratamiento no claro” Progresos médicos: Pancreatitis crónica. Volume 332(22) 1 Jun 1995 pp 1482-1490 Michael L Steer, Irving Waxman, Steven Freedman Orígenes de la Pancreatitis Pre-1896: Pancreatitis es una infección 1896: Pancreatitis es auto digestión del páncreas 1996: Pancreatitis hereditaria es causada por mutaciones en el gen del tripsinógeno catiónico (PRSS1) Pancreatitis hereditaria Pancreatitis hereditaria (PH) es una forma no común de pancreatitis aguda y crónica que se presenta en familias. El riesgo de cáncer pancreático es >50 veces lo normal. Aunque la PH es responsible de sólo el 2.3% de los casos de pancreatitis crónica, el estudio de esta enfermedad ha revolucionado el entendimiento de las enfermedades pancreáticas. Pancreas E-mail Estimado Dr.Whitcomb, Hola. Los médicos piensan que tengo pancreatitis hereditaria debido a que mi papá la tuvo también. Yo no sé mucho, sólo que duele mucho la espalda, los costados y el área del estómago (hablo por experiencia). Estuve en el hospital una vez por eso y fue el pero ataque. Si puede enviarme mayor información, realmente lo aprevciaría. Tengo 12 años y mi padre 42. Que tenga un agradable día Dr.Whitcomb Parientes con PH sin enlace 7q35 Una gran familia fue identificada por auto-referencia 71 miembros 6 afectados 2 portadores Enlace de PH al cromosoma 7q35 D7S505 D7S661 D7S684 D7S523 D7S461 D7S495 D7S483 D7S550 D7S559 -5 3 0 LOD Scores Gen PH 5 Whitcomb et al. GASTROENTEROLOGY 110:1975, 1996 0.00001 0.001 0.1 (Valor de p) 0.01 0.0001 4 2 1 Marcardores en cromosoma 7 Gen de pancreatitis hereditaria Gen de fibrosis quística Cromosoma 7 TCRB
Slide 14 - Pancreatitis y cáncer pancreático David C Whitcomb MD Ph.D. Profesor de Medicina, Biología Celular y Fisiología y Genética Humana Jefe, División de Gastroenterología, Hepatología y Nutrición Director, Centro de Ciencias Genómicas Universidad de Pittsburgh Panorama 1. Origen de la pancreatitis Activación prematura del tripsinógeno 2. Genética de pancreatitis aguda y crónica Tripsinógeno SPINK1 CFTR 3. Cáncer pancreático Ligado a pancreatitis Anatomía del páncreas Histología Ducto Islote Acinis grasa Pancreatitis Páncreas - un órgano que elabora bicarbonato para neutralizar el ácido gástrico, enzimas para digerir el contenido de los alimentos e insulina para que el cuerpo almacene los nutrientes ingeridos. Pancreatitis aguda - Un agudo y potencialmente mortal enfermedad; se presenta con dolor abdominal severo en la que el páncreas parece digerirse a sí mismo. Generalmente es causada por cálculos biliares, el alcohol o idiopática. Pancreatitis crónica - una cicatrización irreversible del páncreas con la pérdida permanente de la función pancreática que suele causar incesante dolor abdominal. Pancreatitis hereditaria – una forma no usual de pancreatitis aguda o crónica, que se presenta en familias. El riesgo de Ca de páncreas en >50 veces de lo normal. Páncreas TC de necrosis pancreática TC de pancreatitis crónica severa Pancreatitis crónica: 1995 “pancreatitis crónica permanece como un proceso enigmático de patogénesis no clara, curso clínico impredecible y tratamiento no claro” Progresos médicos: Pancreatitis crónica. Volume 332(22) 1 Jun 1995 pp 1482-1490 Michael L Steer, Irving Waxman, Steven Freedman Orígenes de la Pancreatitis Pre-1896: Pancreatitis es una infección 1896: Pancreatitis es auto digestión del páncreas 1996: Pancreatitis hereditaria es causada por mutaciones en el gen del tripsinógeno catiónico (PRSS1) Pancreatitis hereditaria Pancreatitis hereditaria (PH) es una forma no común de pancreatitis aguda y crónica que se presenta en familias. El riesgo de cáncer pancreático es >50 veces lo normal. Aunque la PH es responsible de sólo el 2.3% de los casos de pancreatitis crónica, el estudio de esta enfermedad ha revolucionado el entendimiento de las enfermedades pancreáticas. Pancreas E-mail Estimado Dr.Whitcomb, Hola. Los médicos piensan que tengo pancreatitis hereditaria debido a que mi papá la tuvo también. Yo no sé mucho, sólo que duele mucho la espalda, los costados y el área del estómago (hablo por experiencia). Estuve en el hospital una vez por eso y fue el pero ataque. Si puede enviarme mayor información, realmente lo aprevciaría. Tengo 12 años y mi padre 42. Que tenga un agradable día Dr.Whitcomb Parientes con PH sin enlace 7q35 Una gran familia fue identificada por auto-referencia 71 miembros 6 afectados 2 portadores Enlace de PH al cromosoma 7q35 D7S505 D7S661 D7S684 D7S523 D7S461 D7S495 D7S483 D7S550 D7S559 -5 3 0 LOD Scores Gen PH 5 Whitcomb et al. GASTROENTEROLOGY 110:1975, 1996 0.00001 0.001 0.1 (Valor de p) 0.01 0.0001 4 2 1 Marcardores en cromosoma 7 Gen de pancreatitis hereditaria Gen de fibrosis quística Cromosoma 7 TCRB Descubrimiento del gen de la pancreatitis 1. Familia Reclutamiento Whitcomb et al 1996
Slide 15 - Pancreatitis y cáncer pancreático David C Whitcomb MD Ph.D. Profesor de Medicina, Biología Celular y Fisiología y Genética Humana Jefe, División de Gastroenterología, Hepatología y Nutrición Director, Centro de Ciencias Genómicas Universidad de Pittsburgh Panorama 1. Origen de la pancreatitis Activación prematura del tripsinógeno 2. Genética de pancreatitis aguda y crónica Tripsinógeno SPINK1 CFTR 3. Cáncer pancreático Ligado a pancreatitis Anatomía del páncreas Histología Ducto Islote Acinis grasa Pancreatitis Páncreas - un órgano que elabora bicarbonato para neutralizar el ácido gástrico, enzimas para digerir el contenido de los alimentos e insulina para que el cuerpo almacene los nutrientes ingeridos. Pancreatitis aguda - Un agudo y potencialmente mortal enfermedad; se presenta con dolor abdominal severo en la que el páncreas parece digerirse a sí mismo. Generalmente es causada por cálculos biliares, el alcohol o idiopática. Pancreatitis crónica - una cicatrización irreversible del páncreas con la pérdida permanente de la función pancreática que suele causar incesante dolor abdominal. Pancreatitis hereditaria – una forma no usual de pancreatitis aguda o crónica, que se presenta en familias. El riesgo de Ca de páncreas en >50 veces de lo normal. Páncreas TC de necrosis pancreática TC de pancreatitis crónica severa Pancreatitis crónica: 1995 “pancreatitis crónica permanece como un proceso enigmático de patogénesis no clara, curso clínico impredecible y tratamiento no claro” Progresos médicos: Pancreatitis crónica. Volume 332(22) 1 Jun 1995 pp 1482-1490 Michael L Steer, Irving Waxman, Steven Freedman Orígenes de la Pancreatitis Pre-1896: Pancreatitis es una infección 1896: Pancreatitis es auto digestión del páncreas 1996: Pancreatitis hereditaria es causada por mutaciones en el gen del tripsinógeno catiónico (PRSS1) Pancreatitis hereditaria Pancreatitis hereditaria (PH) es una forma no común de pancreatitis aguda y crónica que se presenta en familias. El riesgo de cáncer pancreático es >50 veces lo normal. Aunque la PH es responsible de sólo el 2.3% de los casos de pancreatitis crónica, el estudio de esta enfermedad ha revolucionado el entendimiento de las enfermedades pancreáticas. Pancreas E-mail Estimado Dr.Whitcomb, Hola. Los médicos piensan que tengo pancreatitis hereditaria debido a que mi papá la tuvo también. Yo no sé mucho, sólo que duele mucho la espalda, los costados y el área del estómago (hablo por experiencia). Estuve en el hospital una vez por eso y fue el pero ataque. Si puede enviarme mayor información, realmente lo aprevciaría. Tengo 12 años y mi padre 42. Que tenga un agradable día Dr.Whitcomb Parientes con PH sin enlace 7q35 Una gran familia fue identificada por auto-referencia 71 miembros 6 afectados 2 portadores Enlace de PH al cromosoma 7q35 D7S505 D7S661 D7S684 D7S523 D7S461 D7S495 D7S483 D7S550 D7S559 -5 3 0 LOD Scores Gen PH 5 Whitcomb et al. GASTROENTEROLOGY 110:1975, 1996 0.00001 0.001 0.1 (Valor de p) 0.01 0.0001 4 2 1 Marcardores en cromosoma 7 Gen de pancreatitis hereditaria Gen de fibrosis quística Cromosoma 7 TCRB Descubrimiento del gen de la pancreatitis 1. Familia Reclutamiento Whitcomb et al 1996 Fisiología de Tripsina Enteroquinasa Tripsinógeno Quimiotripsinógeno Proelastasa Procarboxipeptidasa Proenzimas Tripsina Quimiotripsina Elastasa Carboxipeptidasa Enzimas TRIPSINA Solid Food Liquido Alimento sólido
Slide 16 - Pancreatitis y cáncer pancreático David C Whitcomb MD Ph.D. Profesor de Medicina, Biología Celular y Fisiología y Genética Humana Jefe, División de Gastroenterología, Hepatología y Nutrición Director, Centro de Ciencias Genómicas Universidad de Pittsburgh Panorama 1. Origen de la pancreatitis Activación prematura del tripsinógeno 2. Genética de pancreatitis aguda y crónica Tripsinógeno SPINK1 CFTR 3. Cáncer pancreático Ligado a pancreatitis Anatomía del páncreas Histología Ducto Islote Acinis grasa Pancreatitis Páncreas - un órgano que elabora bicarbonato para neutralizar el ácido gástrico, enzimas para digerir el contenido de los alimentos e insulina para que el cuerpo almacene los nutrientes ingeridos. Pancreatitis aguda - Un agudo y potencialmente mortal enfermedad; se presenta con dolor abdominal severo en la que el páncreas parece digerirse a sí mismo. Generalmente es causada por cálculos biliares, el alcohol o idiopática. Pancreatitis crónica - una cicatrización irreversible del páncreas con la pérdida permanente de la función pancreática que suele causar incesante dolor abdominal. Pancreatitis hereditaria – una forma no usual de pancreatitis aguda o crónica, que se presenta en familias. El riesgo de Ca de páncreas en >50 veces de lo normal. Páncreas TC de necrosis pancreática TC de pancreatitis crónica severa Pancreatitis crónica: 1995 “pancreatitis crónica permanece como un proceso enigmático de patogénesis no clara, curso clínico impredecible y tratamiento no claro” Progresos médicos: Pancreatitis crónica. Volume 332(22) 1 Jun 1995 pp 1482-1490 Michael L Steer, Irving Waxman, Steven Freedman Orígenes de la Pancreatitis Pre-1896: Pancreatitis es una infección 1896: Pancreatitis es auto digestión del páncreas 1996: Pancreatitis hereditaria es causada por mutaciones en el gen del tripsinógeno catiónico (PRSS1) Pancreatitis hereditaria Pancreatitis hereditaria (PH) es una forma no común de pancreatitis aguda y crónica que se presenta en familias. El riesgo de cáncer pancreático es >50 veces lo normal. Aunque la PH es responsible de sólo el 2.3% de los casos de pancreatitis crónica, el estudio de esta enfermedad ha revolucionado el entendimiento de las enfermedades pancreáticas. Pancreas E-mail Estimado Dr.Whitcomb, Hola. Los médicos piensan que tengo pancreatitis hereditaria debido a que mi papá la tuvo también. Yo no sé mucho, sólo que duele mucho la espalda, los costados y el área del estómago (hablo por experiencia). Estuve en el hospital una vez por eso y fue el pero ataque. Si puede enviarme mayor información, realmente lo aprevciaría. Tengo 12 años y mi padre 42. Que tenga un agradable día Dr.Whitcomb Parientes con PH sin enlace 7q35 Una gran familia fue identificada por auto-referencia 71 miembros 6 afectados 2 portadores Enlace de PH al cromosoma 7q35 D7S505 D7S661 D7S684 D7S523 D7S461 D7S495 D7S483 D7S550 D7S559 -5 3 0 LOD Scores Gen PH 5 Whitcomb et al. GASTROENTEROLOGY 110:1975, 1996 0.00001 0.001 0.1 (Valor de p) 0.01 0.0001 4 2 1 Marcardores en cromosoma 7 Gen de pancreatitis hereditaria Gen de fibrosis quística Cromosoma 7 TCRB Descubrimiento del gen de la pancreatitis 1. Familia Reclutamiento Whitcomb et al 1996 Fisiología de Tripsina Enteroquinasa Tripsinógeno Quimiotripsinógeno Proelastasa Procarboxipeptidasa Proenzimas Tripsina Quimiotripsina Elastasa Carboxipeptidasa Enzimas TRIPSINA Solid Food Liquido Alimento sólido Inactivación segura de Tripsina Tripsinogeno Tripsina (wt) + - (Autoactivación) Whitcomb et al, Nature Genetics 1996 R122
Slide 17 - Pancreatitis y cáncer pancreático David C Whitcomb MD Ph.D. Profesor de Medicina, Biología Celular y Fisiología y Genética Humana Jefe, División de Gastroenterología, Hepatología y Nutrición Director, Centro de Ciencias Genómicas Universidad de Pittsburgh Panorama 1. Origen de la pancreatitis Activación prematura del tripsinógeno 2. Genética de pancreatitis aguda y crónica Tripsinógeno SPINK1 CFTR 3. Cáncer pancreático Ligado a pancreatitis Anatomía del páncreas Histología Ducto Islote Acinis grasa Pancreatitis Páncreas - un órgano que elabora bicarbonato para neutralizar el ácido gástrico, enzimas para digerir el contenido de los alimentos e insulina para que el cuerpo almacene los nutrientes ingeridos. Pancreatitis aguda - Un agudo y potencialmente mortal enfermedad; se presenta con dolor abdominal severo en la que el páncreas parece digerirse a sí mismo. Generalmente es causada por cálculos biliares, el alcohol o idiopática. Pancreatitis crónica - una cicatrización irreversible del páncreas con la pérdida permanente de la función pancreática que suele causar incesante dolor abdominal. Pancreatitis hereditaria – una forma no usual de pancreatitis aguda o crónica, que se presenta en familias. El riesgo de Ca de páncreas en >50 veces de lo normal. Páncreas TC de necrosis pancreática TC de pancreatitis crónica severa Pancreatitis crónica: 1995 “pancreatitis crónica permanece como un proceso enigmático de patogénesis no clara, curso clínico impredecible y tratamiento no claro” Progresos médicos: Pancreatitis crónica. Volume 332(22) 1 Jun 1995 pp 1482-1490 Michael L Steer, Irving Waxman, Steven Freedman Orígenes de la Pancreatitis Pre-1896: Pancreatitis es una infección 1896: Pancreatitis es auto digestión del páncreas 1996: Pancreatitis hereditaria es causada por mutaciones en el gen del tripsinógeno catiónico (PRSS1) Pancreatitis hereditaria Pancreatitis hereditaria (PH) es una forma no común de pancreatitis aguda y crónica que se presenta en familias. El riesgo de cáncer pancreático es >50 veces lo normal. Aunque la PH es responsible de sólo el 2.3% de los casos de pancreatitis crónica, el estudio de esta enfermedad ha revolucionado el entendimiento de las enfermedades pancreáticas. Pancreas E-mail Estimado Dr.Whitcomb, Hola. Los médicos piensan que tengo pancreatitis hereditaria debido a que mi papá la tuvo también. Yo no sé mucho, sólo que duele mucho la espalda, los costados y el área del estómago (hablo por experiencia). Estuve en el hospital una vez por eso y fue el pero ataque. Si puede enviarme mayor información, realmente lo aprevciaría. Tengo 12 años y mi padre 42. Que tenga un agradable día Dr.Whitcomb Parientes con PH sin enlace 7q35 Una gran familia fue identificada por auto-referencia 71 miembros 6 afectados 2 portadores Enlace de PH al cromosoma 7q35 D7S505 D7S661 D7S684 D7S523 D7S461 D7S495 D7S483 D7S550 D7S559 -5 3 0 LOD Scores Gen PH 5 Whitcomb et al. GASTROENTEROLOGY 110:1975, 1996 0.00001 0.001 0.1 (Valor de p) 0.01 0.0001 4 2 1 Marcardores en cromosoma 7 Gen de pancreatitis hereditaria Gen de fibrosis quística Cromosoma 7 TCRB Descubrimiento del gen de la pancreatitis 1. Familia Reclutamiento Whitcomb et al 1996 Fisiología de Tripsina Enteroquinasa Tripsinógeno Quimiotripsinógeno Proelastasa Procarboxipeptidasa Proenzimas Tripsina Quimiotripsina Elastasa Carboxipeptidasa Enzimas TRIPSINA Solid Food Liquido Alimento sólido Inactivación segura de Tripsina Tripsinogeno Tripsina (wt) + - (Autoactivación) Whitcomb et al, Nature Genetics 1996 R122 Alineamiento y mutaciones de tripsinógeno Whitcomb MCNA 2000
Slide 18 - Pancreatitis y cáncer pancreático David C Whitcomb MD Ph.D. Profesor de Medicina, Biología Celular y Fisiología y Genética Humana Jefe, División de Gastroenterología, Hepatología y Nutrición Director, Centro de Ciencias Genómicas Universidad de Pittsburgh Panorama 1. Origen de la pancreatitis Activación prematura del tripsinógeno 2. Genética de pancreatitis aguda y crónica Tripsinógeno SPINK1 CFTR 3. Cáncer pancreático Ligado a pancreatitis Anatomía del páncreas Histología Ducto Islote Acinis grasa Pancreatitis Páncreas - un órgano que elabora bicarbonato para neutralizar el ácido gástrico, enzimas para digerir el contenido de los alimentos e insulina para que el cuerpo almacene los nutrientes ingeridos. Pancreatitis aguda - Un agudo y potencialmente mortal enfermedad; se presenta con dolor abdominal severo en la que el páncreas parece digerirse a sí mismo. Generalmente es causada por cálculos biliares, el alcohol o idiopática. Pancreatitis crónica - una cicatrización irreversible del páncreas con la pérdida permanente de la función pancreática que suele causar incesante dolor abdominal. Pancreatitis hereditaria – una forma no usual de pancreatitis aguda o crónica, que se presenta en familias. El riesgo de Ca de páncreas en >50 veces de lo normal. Páncreas TC de necrosis pancreática TC de pancreatitis crónica severa Pancreatitis crónica: 1995 “pancreatitis crónica permanece como un proceso enigmático de patogénesis no clara, curso clínico impredecible y tratamiento no claro” Progresos médicos: Pancreatitis crónica. Volume 332(22) 1 Jun 1995 pp 1482-1490 Michael L Steer, Irving Waxman, Steven Freedman Orígenes de la Pancreatitis Pre-1896: Pancreatitis es una infección 1896: Pancreatitis es auto digestión del páncreas 1996: Pancreatitis hereditaria es causada por mutaciones en el gen del tripsinógeno catiónico (PRSS1) Pancreatitis hereditaria Pancreatitis hereditaria (PH) es una forma no común de pancreatitis aguda y crónica que se presenta en familias. El riesgo de cáncer pancreático es >50 veces lo normal. Aunque la PH es responsible de sólo el 2.3% de los casos de pancreatitis crónica, el estudio de esta enfermedad ha revolucionado el entendimiento de las enfermedades pancreáticas. Pancreas E-mail Estimado Dr.Whitcomb, Hola. Los médicos piensan que tengo pancreatitis hereditaria debido a que mi papá la tuvo también. Yo no sé mucho, sólo que duele mucho la espalda, los costados y el área del estómago (hablo por experiencia). Estuve en el hospital una vez por eso y fue el pero ataque. Si puede enviarme mayor información, realmente lo aprevciaría. Tengo 12 años y mi padre 42. Que tenga un agradable día Dr.Whitcomb Parientes con PH sin enlace 7q35 Una gran familia fue identificada por auto-referencia 71 miembros 6 afectados 2 portadores Enlace de PH al cromosoma 7q35 D7S505 D7S661 D7S684 D7S523 D7S461 D7S495 D7S483 D7S550 D7S559 -5 3 0 LOD Scores Gen PH 5 Whitcomb et al. GASTROENTEROLOGY 110:1975, 1996 0.00001 0.001 0.1 (Valor de p) 0.01 0.0001 4 2 1 Marcardores en cromosoma 7 Gen de pancreatitis hereditaria Gen de fibrosis quística Cromosoma 7 TCRB Descubrimiento del gen de la pancreatitis 1. Familia Reclutamiento Whitcomb et al 1996 Fisiología de Tripsina Enteroquinasa Tripsinógeno Quimiotripsinógeno Proelastasa Procarboxipeptidasa Proenzimas Tripsina Quimiotripsina Elastasa Carboxipeptidasa Enzimas TRIPSINA Solid Food Liquido Alimento sólido Inactivación segura de Tripsina Tripsinogeno Tripsina (wt) + - (Autoactivación) Whitcomb et al, Nature Genetics 1996 R122 Alineamiento y mutaciones de tripsinógeno Whitcomb MCNA 2000 Mutaciones PRSS1 - Panorama Dos mutaciones son comunes y causantes de enfermedad: PRSS1 R122H y N29I (nuevos números) Individuos con alguna de las dos mutuaciones tienen casi 80% de probabilidad de desarrollar pancreatitis aguda. De aquellos con pancreatitis aguda, la mitad desarrollan pancreatitis crónica 40% con pancreatitis crónica desarrollarán cáncer pancreático a los 70 años de edad (fumadores duplican el riesgo).
Slide 19 - Pancreatitis y cáncer pancreático David C Whitcomb MD Ph.D. Profesor de Medicina, Biología Celular y Fisiología y Genética Humana Jefe, División de Gastroenterología, Hepatología y Nutrición Director, Centro de Ciencias Genómicas Universidad de Pittsburgh Panorama 1. Origen de la pancreatitis Activación prematura del tripsinógeno 2. Genética de pancreatitis aguda y crónica Tripsinógeno SPINK1 CFTR 3. Cáncer pancreático Ligado a pancreatitis Anatomía del páncreas Histología Ducto Islote Acinis grasa Pancreatitis Páncreas - un órgano que elabora bicarbonato para neutralizar el ácido gástrico, enzimas para digerir el contenido de los alimentos e insulina para que el cuerpo almacene los nutrientes ingeridos. Pancreatitis aguda - Un agudo y potencialmente mortal enfermedad; se presenta con dolor abdominal severo en la que el páncreas parece digerirse a sí mismo. Generalmente es causada por cálculos biliares, el alcohol o idiopática. Pancreatitis crónica - una cicatrización irreversible del páncreas con la pérdida permanente de la función pancreática que suele causar incesante dolor abdominal. Pancreatitis hereditaria – una forma no usual de pancreatitis aguda o crónica, que se presenta en familias. El riesgo de Ca de páncreas en >50 veces de lo normal. Páncreas TC de necrosis pancreática TC de pancreatitis crónica severa Pancreatitis crónica: 1995 “pancreatitis crónica permanece como un proceso enigmático de patogénesis no clara, curso clínico impredecible y tratamiento no claro” Progresos médicos: Pancreatitis crónica. Volume 332(22) 1 Jun 1995 pp 1482-1490 Michael L Steer, Irving Waxman, Steven Freedman Orígenes de la Pancreatitis Pre-1896: Pancreatitis es una infección 1896: Pancreatitis es auto digestión del páncreas 1996: Pancreatitis hereditaria es causada por mutaciones en el gen del tripsinógeno catiónico (PRSS1) Pancreatitis hereditaria Pancreatitis hereditaria (PH) es una forma no común de pancreatitis aguda y crónica que se presenta en familias. El riesgo de cáncer pancreático es >50 veces lo normal. Aunque la PH es responsible de sólo el 2.3% de los casos de pancreatitis crónica, el estudio de esta enfermedad ha revolucionado el entendimiento de las enfermedades pancreáticas. Pancreas E-mail Estimado Dr.Whitcomb, Hola. Los médicos piensan que tengo pancreatitis hereditaria debido a que mi papá la tuvo también. Yo no sé mucho, sólo que duele mucho la espalda, los costados y el área del estómago (hablo por experiencia). Estuve en el hospital una vez por eso y fue el pero ataque. Si puede enviarme mayor información, realmente lo aprevciaría. Tengo 12 años y mi padre 42. Que tenga un agradable día Dr.Whitcomb Parientes con PH sin enlace 7q35 Una gran familia fue identificada por auto-referencia 71 miembros 6 afectados 2 portadores Enlace de PH al cromosoma 7q35 D7S505 D7S661 D7S684 D7S523 D7S461 D7S495 D7S483 D7S550 D7S559 -5 3 0 LOD Scores Gen PH 5 Whitcomb et al. GASTROENTEROLOGY 110:1975, 1996 0.00001 0.001 0.1 (Valor de p) 0.01 0.0001 4 2 1 Marcardores en cromosoma 7 Gen de pancreatitis hereditaria Gen de fibrosis quística Cromosoma 7 TCRB Descubrimiento del gen de la pancreatitis 1. Familia Reclutamiento Whitcomb et al 1996 Fisiología de Tripsina Enteroquinasa Tripsinógeno Quimiotripsinógeno Proelastasa Procarboxipeptidasa Proenzimas Tripsina Quimiotripsina Elastasa Carboxipeptidasa Enzimas TRIPSINA Solid Food Liquido Alimento sólido Inactivación segura de Tripsina Tripsinogeno Tripsina (wt) + - (Autoactivación) Whitcomb et al, Nature Genetics 1996 R122 Alineamiento y mutaciones de tripsinógeno Whitcomb MCNA 2000 Mutaciones PRSS1 - Panorama Dos mutaciones son comunes y causantes de enfermedad: PRSS1 R122H y N29I (nuevos números) Individuos con alguna de las dos mutuaciones tienen casi 80% de probabilidad de desarrollar pancreatitis aguda. De aquellos con pancreatitis aguda, la mitad desarrollan pancreatitis crónica 40% con pancreatitis crónica desarrollarán cáncer pancreático a los 70 años de edad (fumadores duplican el riesgo). Alineamiento y mutaciones SPINK1/PSTI Exon 1 Exon 2 Codon # 1 10 18 24 29 obs var | | P | | | human MKVTGIFLLSALALLSLS * GNTGADSLGRE * Porcine TSPQRE rat MKVAIIFLLSALALLNLA GNTTAKVIGKK | | Peptide # 1 6 Exon 3 Codon # 30 34 40 50 55 60 65 obs var | S |* E S | | human AKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENR * * porcine ATCTSEVSGCPKIYNPVCGTDGITYSNECVLCSENK rat ANCPNTLIGCPRDYDPVCGTDGKTYANECILCFENR | | | | | | Peptide # 7 11 20 30 40 42 Exon 4 Codon # 66 70 79 obs var | | | human KRQTSILIQKSGPC porcine KRQTPVLIQKSGPC rat KFGTSIRIQRRGLC | | | Peptide # 43 50 56 Pfutzer et al, Gastroenterology, 2000 Comparación de de SPINKI/PSTI de hombre, cerdo y rata. Obs var; variaciones observadas en la secuencia de la proteína humana deducida por polimorfismos de alelos. *; el “sebo” lisina (K) en hombre y cerdo, y arginina (R ) en rata que proyecta en el paquete específico de tripsina durante la inhibición de la tripsina. Homología entre humano y porcino de SPINK1 (PSTI) es 71%
Slide 20 - Pancreatitis y cáncer pancreático David C Whitcomb MD Ph.D. Profesor de Medicina, Biología Celular y Fisiología y Genética Humana Jefe, División de Gastroenterología, Hepatología y Nutrición Director, Centro de Ciencias Genómicas Universidad de Pittsburgh Panorama 1. Origen de la pancreatitis Activación prematura del tripsinógeno 2. Genética de pancreatitis aguda y crónica Tripsinógeno SPINK1 CFTR 3. Cáncer pancreático Ligado a pancreatitis Anatomía del páncreas Histología Ducto Islote Acinis grasa Pancreatitis Páncreas - un órgano que elabora bicarbonato para neutralizar el ácido gástrico, enzimas para digerir el contenido de los alimentos e insulina para que el cuerpo almacene los nutrientes ingeridos. Pancreatitis aguda - Un agudo y potencialmente mortal enfermedad; se presenta con dolor abdominal severo en la que el páncreas parece digerirse a sí mismo. Generalmente es causada por cálculos biliares, el alcohol o idiopática. Pancreatitis crónica - una cicatrización irreversible del páncreas con la pérdida permanente de la función pancreática que suele causar incesante dolor abdominal. Pancreatitis hereditaria – una forma no usual de pancreatitis aguda o crónica, que se presenta en familias. El riesgo de Ca de páncreas en >50 veces de lo normal. Páncreas TC de necrosis pancreática TC de pancreatitis crónica severa Pancreatitis crónica: 1995 “pancreatitis crónica permanece como un proceso enigmático de patogénesis no clara, curso clínico impredecible y tratamiento no claro” Progresos médicos: Pancreatitis crónica. Volume 332(22) 1 Jun 1995 pp 1482-1490 Michael L Steer, Irving Waxman, Steven Freedman Orígenes de la Pancreatitis Pre-1896: Pancreatitis es una infección 1896: Pancreatitis es auto digestión del páncreas 1996: Pancreatitis hereditaria es causada por mutaciones en el gen del tripsinógeno catiónico (PRSS1) Pancreatitis hereditaria Pancreatitis hereditaria (PH) es una forma no común de pancreatitis aguda y crónica que se presenta en familias. El riesgo de cáncer pancreático es >50 veces lo normal. Aunque la PH es responsible de sólo el 2.3% de los casos de pancreatitis crónica, el estudio de esta enfermedad ha revolucionado el entendimiento de las enfermedades pancreáticas. Pancreas E-mail Estimado Dr.Whitcomb, Hola. Los médicos piensan que tengo pancreatitis hereditaria debido a que mi papá la tuvo también. Yo no sé mucho, sólo que duele mucho la espalda, los costados y el área del estómago (hablo por experiencia). Estuve en el hospital una vez por eso y fue el pero ataque. Si puede enviarme mayor información, realmente lo aprevciaría. Tengo 12 años y mi padre 42. Que tenga un agradable día Dr.Whitcomb Parientes con PH sin enlace 7q35 Una gran familia fue identificada por auto-referencia 71 miembros 6 afectados 2 portadores Enlace de PH al cromosoma 7q35 D7S505 D7S661 D7S684 D7S523 D7S461 D7S495 D7S483 D7S550 D7S559 -5 3 0 LOD Scores Gen PH 5 Whitcomb et al. GASTROENTEROLOGY 110:1975, 1996 0.00001 0.001 0.1 (Valor de p) 0.01 0.0001 4 2 1 Marcardores en cromosoma 7 Gen de pancreatitis hereditaria Gen de fibrosis quística Cromosoma 7 TCRB Descubrimiento del gen de la pancreatitis 1. Familia Reclutamiento Whitcomb et al 1996 Fisiología de Tripsina Enteroquinasa Tripsinógeno Quimiotripsinógeno Proelastasa Procarboxipeptidasa Proenzimas Tripsina Quimiotripsina Elastasa Carboxipeptidasa Enzimas TRIPSINA Solid Food Liquido Alimento sólido Inactivación segura de Tripsina Tripsinogeno Tripsina (wt) + - (Autoactivación) Whitcomb et al, Nature Genetics 1996 R122 Alineamiento y mutaciones de tripsinógeno Whitcomb MCNA 2000 Mutaciones PRSS1 - Panorama Dos mutaciones son comunes y causantes de enfermedad: PRSS1 R122H y N29I (nuevos números) Individuos con alguna de las dos mutuaciones tienen casi 80% de probabilidad de desarrollar pancreatitis aguda. De aquellos con pancreatitis aguda, la mitad desarrollan pancreatitis crónica 40% con pancreatitis crónica desarrollarán cáncer pancreático a los 70 años de edad (fumadores duplican el riesgo). Alineamiento y mutaciones SPINK1/PSTI Exon 1 Exon 2 Codon # 1 10 18 24 29 obs var | | P | | | human MKVTGIFLLSALALLSLS * GNTGADSLGRE * Porcine TSPQRE rat MKVAIIFLLSALALLNLA GNTTAKVIGKK | | Peptide # 1 6 Exon 3 Codon # 30 34 40 50 55 60 65 obs var | S |* E S | | human AKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENR * * porcine ATCTSEVSGCPKIYNPVCGTDGITYSNECVLCSENK rat ANCPNTLIGCPRDYDPVCGTDGKTYANECILCFENR | | | | | | Peptide # 7 11 20 30 40 42 Exon 4 Codon # 66 70 79 obs var | | | human KRQTSILIQKSGPC porcine KRQTPVLIQKSGPC rat KFGTSIRIQRRGLC | | | Peptide # 43 50 56 Pfutzer et al, Gastroenterology, 2000 Comparación de de SPINKI/PSTI de hombre, cerdo y rata. Obs var; variaciones observadas en la secuencia de la proteína humana deducida por polimorfismos de alelos. *; el “sebo” lisina (K) en hombre y cerdo, y arginina (R ) en rata que proyecta en el paquete específico de tripsina durante la inhibición de la tripsina. Homología entre humano y porcino de SPINK1 (PSTI) es 71% Mutación SPINK1 / PSTI N34S Superposición de la estructura porcina SPINK1 (azul) sobre estructura SPINKI humano (modificado para quimiotripsina) (rojo). Modelo por Andrew Brunskil y William F. Furey Pfutzer et al, Gastroenterology, 2000
Slide 21 - Pancreatitis y cáncer pancreático David C Whitcomb MD Ph.D. Profesor de Medicina, Biología Celular y Fisiología y Genética Humana Jefe, División de Gastroenterología, Hepatología y Nutrición Director, Centro de Ciencias Genómicas Universidad de Pittsburgh Panorama 1. Origen de la pancreatitis Activación prematura del tripsinógeno 2. Genética de pancreatitis aguda y crónica Tripsinógeno SPINK1 CFTR 3. Cáncer pancreático Ligado a pancreatitis Anatomía del páncreas Histología Ducto Islote Acinis grasa Pancreatitis Páncreas - un órgano que elabora bicarbonato para neutralizar el ácido gástrico, enzimas para digerir el contenido de los alimentos e insulina para que el cuerpo almacene los nutrientes ingeridos. Pancreatitis aguda - Un agudo y potencialmente mortal enfermedad; se presenta con dolor abdominal severo en la que el páncreas parece digerirse a sí mismo. Generalmente es causada por cálculos biliares, el alcohol o idiopática. Pancreatitis crónica - una cicatrización irreversible del páncreas con la pérdida permanente de la función pancreática que suele causar incesante dolor abdominal. Pancreatitis hereditaria – una forma no usual de pancreatitis aguda o crónica, que se presenta en familias. El riesgo de Ca de páncreas en >50 veces de lo normal. Páncreas TC de necrosis pancreática TC de pancreatitis crónica severa Pancreatitis crónica: 1995 “pancreatitis crónica permanece como un proceso enigmático de patogénesis no clara, curso clínico impredecible y tratamiento no claro” Progresos médicos: Pancreatitis crónica. Volume 332(22) 1 Jun 1995 pp 1482-1490 Michael L Steer, Irving Waxman, Steven Freedman Orígenes de la Pancreatitis Pre-1896: Pancreatitis es una infección 1896: Pancreatitis es auto digestión del páncreas 1996: Pancreatitis hereditaria es causada por mutaciones en el gen del tripsinógeno catiónico (PRSS1) Pancreatitis hereditaria Pancreatitis hereditaria (PH) es una forma no común de pancreatitis aguda y crónica que se presenta en familias. El riesgo de cáncer pancreático es >50 veces lo normal. Aunque la PH es responsible de sólo el 2.3% de los casos de pancreatitis crónica, el estudio de esta enfermedad ha revolucionado el entendimiento de las enfermedades pancreáticas. Pancreas E-mail Estimado Dr.Whitcomb, Hola. Los médicos piensan que tengo pancreatitis hereditaria debido a que mi papá la tuvo también. Yo no sé mucho, sólo que duele mucho la espalda, los costados y el área del estómago (hablo por experiencia). Estuve en el hospital una vez por eso y fue el pero ataque. Si puede enviarme mayor información, realmente lo aprevciaría. Tengo 12 años y mi padre 42. Que tenga un agradable día Dr.Whitcomb Parientes con PH sin enlace 7q35 Una gran familia fue identificada por auto-referencia 71 miembros 6 afectados 2 portadores Enlace de PH al cromosoma 7q35 D7S505 D7S661 D7S684 D7S523 D7S461 D7S495 D7S483 D7S550 D7S559 -5 3 0 LOD Scores Gen PH 5 Whitcomb et al. GASTROENTEROLOGY 110:1975, 1996 0.00001 0.001 0.1 (Valor de p) 0.01 0.0001 4 2 1 Marcardores en cromosoma 7 Gen de pancreatitis hereditaria Gen de fibrosis quística Cromosoma 7 TCRB Descubrimiento del gen de la pancreatitis 1. Familia Reclutamiento Whitcomb et al 1996 Fisiología de Tripsina Enteroquinasa Tripsinógeno Quimiotripsinógeno Proelastasa Procarboxipeptidasa Proenzimas Tripsina Quimiotripsina Elastasa Carboxipeptidasa Enzimas TRIPSINA Solid Food Liquido Alimento sólido Inactivación segura de Tripsina Tripsinogeno Tripsina (wt) + - (Autoactivación) Whitcomb et al, Nature Genetics 1996 R122 Alineamiento y mutaciones de tripsinógeno Whitcomb MCNA 2000 Mutaciones PRSS1 - Panorama Dos mutaciones son comunes y causantes de enfermedad: PRSS1 R122H y N29I (nuevos números) Individuos con alguna de las dos mutuaciones tienen casi 80% de probabilidad de desarrollar pancreatitis aguda. De aquellos con pancreatitis aguda, la mitad desarrollan pancreatitis crónica 40% con pancreatitis crónica desarrollarán cáncer pancreático a los 70 años de edad (fumadores duplican el riesgo). Alineamiento y mutaciones SPINK1/PSTI Exon 1 Exon 2 Codon # 1 10 18 24 29 obs var | | P | | | human MKVTGIFLLSALALLSLS * GNTGADSLGRE * Porcine TSPQRE rat MKVAIIFLLSALALLNLA GNTTAKVIGKK | | Peptide # 1 6 Exon 3 Codon # 30 34 40 50 55 60 65 obs var | S |* E S | | human AKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENR * * porcine ATCTSEVSGCPKIYNPVCGTDGITYSNECVLCSENK rat ANCPNTLIGCPRDYDPVCGTDGKTYANECILCFENR | | | | | | Peptide # 7 11 20 30 40 42 Exon 4 Codon # 66 70 79 obs var | | | human KRQTSILIQKSGPC porcine KRQTPVLIQKSGPC rat KFGTSIRIQRRGLC | | | Peptide # 43 50 56 Pfutzer et al, Gastroenterology, 2000 Comparación de de SPINKI/PSTI de hombre, cerdo y rata. Obs var; variaciones observadas en la secuencia de la proteína humana deducida por polimorfismos de alelos. *; el “sebo” lisina (K) en hombre y cerdo, y arginina (R ) en rata que proyecta en el paquete específico de tripsina durante la inhibición de la tripsina. Homología entre humano y porcino de SPINK1 (PSTI) es 71% Mutación SPINK1 / PSTI N34S Superposición de la estructura porcina SPINK1 (azul) sobre estructura SPINKI humano (modificado para quimiotripsina) (rojo). Modelo por Andrew Brunskil y William F. Furey Pfutzer et al, Gastroenterology, 2000 Genotipo-Fenotipo SPINK1 65 60 55 50 45 40 35 30 25 20 15 10 5 0 0 10 20 30 40 50 60 70 80 90 100 SPINK1 N34S Incidencia acumulada de pancrratitis Edad d ataque de síntoma (años) Afectados (% total) SPINK1 N34S / N34S Pfutzer et al, Gastroenterology, 2000
Slide 22 - Pancreatitis y cáncer pancreático David C Whitcomb MD Ph.D. Profesor de Medicina, Biología Celular y Fisiología y Genética Humana Jefe, División de Gastroenterología, Hepatología y Nutrición Director, Centro de Ciencias Genómicas Universidad de Pittsburgh Panorama 1. Origen de la pancreatitis Activación prematura del tripsinógeno 2. Genética de pancreatitis aguda y crónica Tripsinógeno SPINK1 CFTR 3. Cáncer pancreático Ligado a pancreatitis Anatomía del páncreas Histología Ducto Islote Acinis grasa Pancreatitis Páncreas - un órgano que elabora bicarbonato para neutralizar el ácido gástrico, enzimas para digerir el contenido de los alimentos e insulina para que el cuerpo almacene los nutrientes ingeridos. Pancreatitis aguda - Un agudo y potencialmente mortal enfermedad; se presenta con dolor abdominal severo en la que el páncreas parece digerirse a sí mismo. Generalmente es causada por cálculos biliares, el alcohol o idiopática. Pancreatitis crónica - una cicatrización irreversible del páncreas con la pérdida permanente de la función pancreática que suele causar incesante dolor abdominal. Pancreatitis hereditaria – una forma no usual de pancreatitis aguda o crónica, que se presenta en familias. El riesgo de Ca de páncreas en >50 veces de lo normal. Páncreas TC de necrosis pancreática TC de pancreatitis crónica severa Pancreatitis crónica: 1995 “pancreatitis crónica permanece como un proceso enigmático de patogénesis no clara, curso clínico impredecible y tratamiento no claro” Progresos médicos: Pancreatitis crónica. Volume 332(22) 1 Jun 1995 pp 1482-1490 Michael L Steer, Irving Waxman, Steven Freedman Orígenes de la Pancreatitis Pre-1896: Pancreatitis es una infección 1896: Pancreatitis es auto digestión del páncreas 1996: Pancreatitis hereditaria es causada por mutaciones en el gen del tripsinógeno catiónico (PRSS1) Pancreatitis hereditaria Pancreatitis hereditaria (PH) es una forma no común de pancreatitis aguda y crónica que se presenta en familias. El riesgo de cáncer pancreático es >50 veces lo normal. Aunque la PH es responsible de sólo el 2.3% de los casos de pancreatitis crónica, el estudio de esta enfermedad ha revolucionado el entendimiento de las enfermedades pancreáticas. Pancreas E-mail Estimado Dr.Whitcomb, Hola. Los médicos piensan que tengo pancreatitis hereditaria debido a que mi papá la tuvo también. Yo no sé mucho, sólo que duele mucho la espalda, los costados y el área del estómago (hablo por experiencia). Estuve en el hospital una vez por eso y fue el pero ataque. Si puede enviarme mayor información, realmente lo aprevciaría. Tengo 12 años y mi padre 42. Que tenga un agradable día Dr.Whitcomb Parientes con PH sin enlace 7q35 Una gran familia fue identificada por auto-referencia 71 miembros 6 afectados 2 portadores Enlace de PH al cromosoma 7q35 D7S505 D7S661 D7S684 D7S523 D7S461 D7S495 D7S483 D7S550 D7S559 -5 3 0 LOD Scores Gen PH 5 Whitcomb et al. GASTROENTEROLOGY 110:1975, 1996 0.00001 0.001 0.1 (Valor de p) 0.01 0.0001 4 2 1 Marcardores en cromosoma 7 Gen de pancreatitis hereditaria Gen de fibrosis quística Cromosoma 7 TCRB Descubrimiento del gen de la pancreatitis 1. Familia Reclutamiento Whitcomb et al 1996 Fisiología de Tripsina Enteroquinasa Tripsinógeno Quimiotripsinógeno Proelastasa Procarboxipeptidasa Proenzimas Tripsina Quimiotripsina Elastasa Carboxipeptidasa Enzimas TRIPSINA Solid Food Liquido Alimento sólido Inactivación segura de Tripsina Tripsinogeno Tripsina (wt) + - (Autoactivación) Whitcomb et al, Nature Genetics 1996 R122 Alineamiento y mutaciones de tripsinógeno Whitcomb MCNA 2000 Mutaciones PRSS1 - Panorama Dos mutaciones son comunes y causantes de enfermedad: PRSS1 R122H y N29I (nuevos números) Individuos con alguna de las dos mutuaciones tienen casi 80% de probabilidad de desarrollar pancreatitis aguda. De aquellos con pancreatitis aguda, la mitad desarrollan pancreatitis crónica 40% con pancreatitis crónica desarrollarán cáncer pancreático a los 70 años de edad (fumadores duplican el riesgo). Alineamiento y mutaciones SPINK1/PSTI Exon 1 Exon 2 Codon # 1 10 18 24 29 obs var | | P | | | human MKVTGIFLLSALALLSLS * GNTGADSLGRE * Porcine TSPQRE rat MKVAIIFLLSALALLNLA GNTTAKVIGKK | | Peptide # 1 6 Exon 3 Codon # 30 34 40 50 55 60 65 obs var | S |* E S | | human AKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENR * * porcine ATCTSEVSGCPKIYNPVCGTDGITYSNECVLCSENK rat ANCPNTLIGCPRDYDPVCGTDGKTYANECILCFENR | | | | | | Peptide # 7 11 20 30 40 42 Exon 4 Codon # 66 70 79 obs var | | | human KRQTSILIQKSGPC porcine KRQTPVLIQKSGPC rat KFGTSIRIQRRGLC | | | Peptide # 43 50 56 Pfutzer et al, Gastroenterology, 2000 Comparación de de SPINKI/PSTI de hombre, cerdo y rata. Obs var; variaciones observadas en la secuencia de la proteína humana deducida por polimorfismos de alelos. *; el “sebo” lisina (K) en hombre y cerdo, y arginina (R ) en rata que proyecta en el paquete específico de tripsina durante la inhibición de la tripsina. Homología entre humano y porcino de SPINK1 (PSTI) es 71% Mutación SPINK1 / PSTI N34S Superposición de la estructura porcina SPINK1 (azul) sobre estructura SPINKI humano (modificado para quimiotripsina) (rojo). Modelo por Andrew Brunskil y William F. Furey Pfutzer et al, Gastroenterology, 2000 Genotipo-Fenotipo SPINK1 65 60 55 50 45 40 35 30 25 20 15 10 5 0 0 10 20 30 40 50 60 70 80 90 100 SPINK1 N34S Incidencia acumulada de pancrratitis Edad d ataque de síntoma (años) Afectados (% total) SPINK1 N34S / N34S Pfutzer et al, Gastroenterology, 2000 Mutaciones SPINK1 - Panorama Mutaciones SPINK1/PSTI son comunes en la población (~2%) SPINK1/PSTI están asociados con ICP (~25%). El riesgo asociado a la mutación es bajo (<1%). Modelaje y grupo familiar sugiere que mutaciones SPINK1 modifican la enfermedad. Mutaciones SPINK1/PSTI puede disminuir el umbral para pancreatitis de otros factores ambientales o genéticos, pero no son causantes de enfermedad. La mutación N34S tiene distribución mundial-
Slide 23 - Pancreatitis y cáncer pancreático David C Whitcomb MD Ph.D. Profesor de Medicina, Biología Celular y Fisiología y Genética Humana Jefe, División de Gastroenterología, Hepatología y Nutrición Director, Centro de Ciencias Genómicas Universidad de Pittsburgh Panorama 1. Origen de la pancreatitis Activación prematura del tripsinógeno 2. Genética de pancreatitis aguda y crónica Tripsinógeno SPINK1 CFTR 3. Cáncer pancreático Ligado a pancreatitis Anatomía del páncreas Histología Ducto Islote Acinis grasa Pancreatitis Páncreas - un órgano que elabora bicarbonato para neutralizar el ácido gástrico, enzimas para digerir el contenido de los alimentos e insulina para que el cuerpo almacene los nutrientes ingeridos. Pancreatitis aguda - Un agudo y potencialmente mortal enfermedad; se presenta con dolor abdominal severo en la que el páncreas parece digerirse a sí mismo. Generalmente es causada por cálculos biliares, el alcohol o idiopática. Pancreatitis crónica - una cicatrización irreversible del páncreas con la pérdida permanente de la función pancreática que suele causar incesante dolor abdominal. Pancreatitis hereditaria – una forma no usual de pancreatitis aguda o crónica, que se presenta en familias. El riesgo de Ca de páncreas en >50 veces de lo normal. Páncreas TC de necrosis pancreática TC de pancreatitis crónica severa Pancreatitis crónica: 1995 “pancreatitis crónica permanece como un proceso enigmático de patogénesis no clara, curso clínico impredecible y tratamiento no claro” Progresos médicos: Pancreatitis crónica. Volume 332(22) 1 Jun 1995 pp 1482-1490 Michael L Steer, Irving Waxman, Steven Freedman Orígenes de la Pancreatitis Pre-1896: Pancreatitis es una infección 1896: Pancreatitis es auto digestión del páncreas 1996: Pancreatitis hereditaria es causada por mutaciones en el gen del tripsinógeno catiónico (PRSS1) Pancreatitis hereditaria Pancreatitis hereditaria (PH) es una forma no común de pancreatitis aguda y crónica que se presenta en familias. El riesgo de cáncer pancreático es >50 veces lo normal. Aunque la PH es responsible de sólo el 2.3% de los casos de pancreatitis crónica, el estudio de esta enfermedad ha revolucionado el entendimiento de las enfermedades pancreáticas. Pancreas E-mail Estimado Dr.Whitcomb, Hola. Los médicos piensan que tengo pancreatitis hereditaria debido a que mi papá la tuvo también. Yo no sé mucho, sólo que duele mucho la espalda, los costados y el área del estómago (hablo por experiencia). Estuve en el hospital una vez por eso y fue el pero ataque. Si puede enviarme mayor información, realmente lo aprevciaría. Tengo 12 años y mi padre 42. Que tenga un agradable día Dr.Whitcomb Parientes con PH sin enlace 7q35 Una gran familia fue identificada por auto-referencia 71 miembros 6 afectados 2 portadores Enlace de PH al cromosoma 7q35 D7S505 D7S661 D7S684 D7S523 D7S461 D7S495 D7S483 D7S550 D7S559 -5 3 0 LOD Scores Gen PH 5 Whitcomb et al. GASTROENTEROLOGY 110:1975, 1996 0.00001 0.001 0.1 (Valor de p) 0.01 0.0001 4 2 1 Marcardores en cromosoma 7 Gen de pancreatitis hereditaria Gen de fibrosis quística Cromosoma 7 TCRB Descubrimiento del gen de la pancreatitis 1. Familia Reclutamiento Whitcomb et al 1996 Fisiología de Tripsina Enteroquinasa Tripsinógeno Quimiotripsinógeno Proelastasa Procarboxipeptidasa Proenzimas Tripsina Quimiotripsina Elastasa Carboxipeptidasa Enzimas TRIPSINA Solid Food Liquido Alimento sólido Inactivación segura de Tripsina Tripsinogeno Tripsina (wt) + - (Autoactivación) Whitcomb et al, Nature Genetics 1996 R122 Alineamiento y mutaciones de tripsinógeno Whitcomb MCNA 2000 Mutaciones PRSS1 - Panorama Dos mutaciones son comunes y causantes de enfermedad: PRSS1 R122H y N29I (nuevos números) Individuos con alguna de las dos mutuaciones tienen casi 80% de probabilidad de desarrollar pancreatitis aguda. De aquellos con pancreatitis aguda, la mitad desarrollan pancreatitis crónica 40% con pancreatitis crónica desarrollarán cáncer pancreático a los 70 años de edad (fumadores duplican el riesgo). Alineamiento y mutaciones SPINK1/PSTI Exon 1 Exon 2 Codon # 1 10 18 24 29 obs var | | P | | | human MKVTGIFLLSALALLSLS * GNTGADSLGRE * Porcine TSPQRE rat MKVAIIFLLSALALLNLA GNTTAKVIGKK | | Peptide # 1 6 Exon 3 Codon # 30 34 40 50 55 60 65 obs var | S |* E S | | human AKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENR * * porcine ATCTSEVSGCPKIYNPVCGTDGITYSNECVLCSENK rat ANCPNTLIGCPRDYDPVCGTDGKTYANECILCFENR | | | | | | Peptide # 7 11 20 30 40 42 Exon 4 Codon # 66 70 79 obs var | | | human KRQTSILIQKSGPC porcine KRQTPVLIQKSGPC rat KFGTSIRIQRRGLC | | | Peptide # 43 50 56 Pfutzer et al, Gastroenterology, 2000 Comparación de de SPINKI/PSTI de hombre, cerdo y rata. Obs var; variaciones observadas en la secuencia de la proteína humana deducida por polimorfismos de alelos. *; el “sebo” lisina (K) en hombre y cerdo, y arginina (R ) en rata que proyecta en el paquete específico de tripsina durante la inhibición de la tripsina. Homología entre humano y porcino de SPINK1 (PSTI) es 71% Mutación SPINK1 / PSTI N34S Superposición de la estructura porcina SPINK1 (azul) sobre estructura SPINKI humano (modificado para quimiotripsina) (rojo). Modelo por Andrew Brunskil y William F. Furey Pfutzer et al, Gastroenterology, 2000 Genotipo-Fenotipo SPINK1 65 60 55 50 45 40 35 30 25 20 15 10 5 0 0 10 20 30 40 50 60 70 80 90 100 SPINK1 N34S Incidencia acumulada de pancrratitis Edad d ataque de síntoma (años) Afectados (% total) SPINK1 N34S / N34S Pfutzer et al, Gastroenterology, 2000 Mutaciones SPINK1 - Panorama Mutaciones SPINK1/PSTI son comunes en la población (~2%) SPINK1/PSTI están asociados con ICP (~25%). El riesgo asociado a la mutación es bajo (<1%). Modelaje y grupo familiar sugiere que mutaciones SPINK1 modifican la enfermedad. Mutaciones SPINK1/PSTI puede disminuir el umbral para pancreatitis de otros factores ambientales o genéticos, pero no son causantes de enfermedad. La mutación N34S tiene distribución mundial- Tabaquismo y riesgo de cáncer en HP Edad de dx de Ca páncreas GP HP HP + Fumadores 150 100 50 0 Riesgo Relativo Edad (Años) Riesgo de Ca pancreático A.B. Lowenfels, P. Maisonneuve, D. C.Whitcomb, and the International Hereditary Pancreatitis Study Group