This site uses cookies to deliver our services and to show you relevant ads and presentations. By clicking on "Accept", you acknowledge that you have read and understand our Cookie Policy , Privacy Policy , and our Terms of Use.
X

Download Color Blindness PowerPoint Presentation


Login   OR  Register
X


Iframe embed code :



Presentation url :

X

Description :

Available Color Blindness powerpoint presentation for free download which is uploaded by search an active user in belonging ppt presentation Health & Wellness category.

Tags :

Color Blindness

Home / Health & Wellness / Health & Wellness Presentations / Color Blindness PowerPoint Presentation

Color Blindness PowerPoint Presentation

Ppt Presentation Embed Code   Zoom Ppt Presentation

About This Presentation


Description : Available Color Blindness powerpoint presentation for free download which is uploaded by search an a... Read More

Tags : Color Blindness

Published on : Mar 14, 2014
Views : 570 | Downloads : 0


Download Now

Share on Social Media

             

PowerPoint is the world's most popular presentation software which can let you create professional Color Blindness powerpoint presentation easily and in no time. This helps you give your presentation on Color Blindness in a conference, a school lecture, a business proposal, in a webinar and business and professional representations.

The uploader spent his/her valuable time to create this Color Blindness powerpoint presentation slides, to share his/her useful content with the world. This ppt presentation uploaded by onlinesearch in this Health & Wellness category is available for free download,and can be used according to your industries like finance, marketing, education, health and many more.

SlidesFinder.com provides a platform to marketers, presenters and educationists along with being the preferred search engine for professional PowerPoint presentations on the Internet to upload their Color Blindness ppt presentation slides to help them BUILD THEIR CROWD!!

User Presentation
Related Presentation
Free PowerPoint Templates
Slide 1 - Color Blindness By Jessie Wright
Slide 2 - Normally, there are three kinds of cones (each one sensitive to a specific range of wavelengths): "red" cones (64%) "green" cones (32%) "blue" cones (2%) The normal human retina contains two kinds of light sensitive cells: the rod cells (active only in low light) and the cone cells (active in normal daylight and responsible for color perception). Let there be light!!! The different kinds of inherited color blindness result from partial or complete loss of function of one or more of the different cone systems.
Slide 3 - Different Types of Color Blindness Monochromacy: occurs when two or all three of the cone pigments are missing and color and lightness vision is reduced to one dimension. Total color blindness Dichromacy: occurs when only one of the cone pigments is missing and color is reduced to two dimensions. Partial color blindness red-green blue-yellow
Slide 4 - Total Color Blindness Also known as rod monochromacy, complete achromatopsia, and typical monochromacy. A rare, non-progressive inability to distinguish any colors as a result of absent or nonfunctioning retinal cones. See everything as white, black, or some shade of gray Typically caused by a missense mutation (a switched amino acid) in the CNGB3 gene.
Slide 5 - CYCLIC NUCLEOTIDE-GATED CHANNEL, BETA-3 (CNGB3) Classic achromatopsia results from a complete loss of CNGB3 function. CNGB3 encodes for the beta subunit of the cone cyclic nucleotide-gated cation channel, found photoreceptor plasma membranes. Upon activation by cGMP, it leads to an opening of cation channels which thereby cause a depolarization of rod photoreceptors. This gene is essential for the generation of light-evoked electrical responses in cones. CNGB3 is not required for vital processes outside the visual system.
Slide 6 - CNGB3 Cont. The human CNGB3 gene consists of 18 exons distributed over 200 kb of genomic sequence. Gene type: protein coding Domain: similar to ion transport protein Cytogenetic locus: chromosome: 8; Location: 8q21-q22
Slide 7 - Amino acid sequence Length: 809 aa "MFKSLTKVNKVKPIGENNENEQSSRRNEEGSHPSNQSQQTTAQE ENKGEEKSLKTKSTPVTSEEPHTNIQDKLSKKNSSGDLTTNPDPQNAAEPTGTVPEQK EMDPGKEGPNSPQNKPPAAPVINEYADAQLHNLVKRMRQRTALYKKKLVEGDLSSPEA SPQTAKPTAVPPVKESDDKPTEHYYRLLWFKVKKMPLTEYLKRIKLPNSIDSYTDRLY LLWLLLVTLAYNWNCWFIPLRLVFPYQTADNIHYWLIADIICDIIYLYDMLFIQPRLQ FVRGGDIIVDSNELRKHYRTSTKFQLDVASIIPFDICYLFFGFNPMFRANRMLKYTSF FEFNHHLESIMDKAYIYRVIRTTGYLLFILHINACVYYWASNYEGIGTTRWVYDGEGN EYLRCYYWAVRTLITIGGLPEPQTLFEIVFQLLNFFSGVFVFSSLIGQMRDVIGAATA NQNYFRACMDDTIAYMNNYSIPKLVQKRVRTWYEYTWDSQRMLDESDLLKTLPTTVQL ALAIDVNFSIISKVDLFKGCDTQMIYDMLLRLKSVLYLPGDFVCKKGEIGKEMYIIKH GEVQVLGGPDGTKVLVTLKAGSVFGEISLLAAGGGNRRTANVVAHGFANLLTLDKKTL QEILVHYPDSERILMKKARVLLKQKAKTAEATPPRKDLALLFPPKEETPKLFKTLLGG TGKASLARLLKLKREQAAQKKENSEGGEEEGKENEDKQKENEDKQKENEDKGKENEDK DKGREPEEKPLDRPECTASPIAVEEEPHSVRRTVLPRGTSRQSLIISMAPSAEGGEEV LTIEVKEKAKQ"
Slide 8 - Mutation… The genetic basis for achromatopsia is found on chromosome 8 (location 8q21-q22) where there is a recessive point mutation in CNGB3 that changes serine at residue 435 to phenylalanine in a highly conserved site in the S6 membrane-spanning domain.
Slide 9 - Bibliography Bookshelf: Samir S Deeb, PhD, Arno G Motulsky, MD, “Red-Green Color Vision Defects,” GeneReviews, September 19, 2005. Berg, Jeremy M. “32.3.5. Rearrangements in the Genes for the Green and Red Pigments Lead to ‘Color Blindness,’” Biochemistry 5th edition, W.H. Freeman and Company, 2002. OMIM: “COLORBLINDNESS, PARTIAL, DEUTAN SERIES; CBD” OMIM ID: 303800 PubMed: Harrison, R.; Hoefnagel, D.; Hayward, J. N. “Congenital total color blindness.” Arch. Ophthal. 64: 685-692, 1960. PubMed ID: 13711836 Botstein, D. “The molecular biology of color vision.” (Editorial) Science 232: 142-143, 1986. PubMed ID: 2937146 Reyniers, E.; Van Thienen, M.-N.; Meire, F.; De Boulle, K.; Devries, K.; Kestelijn, P.; Willems, P. J. “Gene conversion between red and defective green opsin gene in blue cone monochromacy.” Genomics 29: 323-328, 1995. PubMed ID: 8666378 Winderickx, J.; Sanocki, E.; Lindsey, D. T.; Teller, D. Y.; Motulsky, A. G.; Deeb, S. S. : “Defective colour vision associated with a missense mutation in the human green visual pigment gene.” Nature Genet. 1: 251-256, 1992. PubMed ID: 1302020