X

Download Color Blindness PowerPoint Presentation

SlidesFinder-Advertising-Design.jpg

Login   OR  Register
X


Iframe embed code :



Presentation url :

Home / Health & Wellness / Health & Wellness Presentations / Color Blindness PowerPoint Presentation

Color Blindness PowerPoint Presentation

Ppt Presentation Embed Code   Zoom Ppt Presentation

PowerPoint is the world's most popular presentation software which can let you create professional Color Blindness powerpoint presentation easily and in no time. This helps you give your presentation on Color Blindness in a conference, a school lecture, a business proposal, in a webinar and business and professional representations.

The uploader spent his/her valuable time to create this Color Blindness powerpoint presentation slides, to share his/her useful content with the world. This ppt presentation uploaded by onlinesearch in Health & Wellness ppt presentation category is available for free download,and can be used according to your industries like finance, marketing, education, health and many more.

About This Presentation

Slide 1 - Color Blindness By Jessie Wright
Slide 2 - Normally, there are three kinds of cones (each one sensitive to a specific range of wavelengths): "red" cones (64%) "green" cones (32%) "blue" cones (2%) The normal human retina contains two kinds of light sensitive cells: the rod cells (active only in low light) and the cone cells (active in normal daylight and responsible for color perception). Let there be light!!! The different kinds of inherited color blindness result from partial or complete loss of function of one or more of the different cone systems.
Slide 3 - Different Types of Color Blindness Monochromacy: occurs when two or all three of the cone pigments are missing and color and lightness vision is reduced to one dimension. Total color blindness Dichromacy: occurs when only one of the cone pigments is missing and color is reduced to two dimensions. Partial color blindness red-green blue-yellow
Slide 4 - Total Color Blindness Also known as rod monochromacy, complete achromatopsia, and typical monochromacy. A rare, non-progressive inability to distinguish any colors as a result of absent or nonfunctioning retinal cones. See everything as white, black, or some shade of gray Typically caused by a missense mutation (a switched amino acid) in the CNGB3 gene.
Slide 5 - CYCLIC NUCLEOTIDE-GATED CHANNEL, BETA-3 (CNGB3) Classic achromatopsia results from a complete loss of CNGB3 function. CNGB3 encodes for the beta subunit of the cone cyclic nucleotide-gated cation channel, found photoreceptor plasma membranes. Upon activation by cGMP, it leads to an opening of cation channels which thereby cause a depolarization of rod photoreceptors. This gene is essential for the generation of light-evoked electrical responses in cones. CNGB3 is not required for vital processes outside the visual system.
Slide 6 - CNGB3 Cont. The human CNGB3 gene consists of 18 exons distributed over 200 kb of genomic sequence. Gene type: protein coding Domain: similar to ion transport protein Cytogenetic locus: chromosome: 8; Location: 8q21-q22
Slide 7 - Amino acid sequence Length: 809 aa "MFKSLTKVNKVKPIGENNENEQSSRRNEEGSHPSNQSQQTTAQE ENKGEEKSLKTKSTPVTSEEPHTNIQDKLSKKNSSGDLTTNPDPQNAAEPTGTVPEQK EMDPGKEGPNSPQNKPPAAPVINEYADAQLHNLVKRMRQRTALYKKKLVEGDLSSPEA SPQTAKPTAVPPVKESDDKPTEHYYRLLWFKVKKMPLTEYLKRIKLPNSIDSYTDRLY LLWLLLVTLAYNWNCWFIPLRLVFPYQTADNIHYWLIADIICDIIYLYDMLFIQPRLQ FVRGGDIIVDSNELRKHYRTSTKFQLDVASIIPFDICYLFFGFNPMFRANRMLKYTSF FEFNHHLESIMDKAYIYRVIRTTGYLLFILHINACVYYWASNYEGIGTTRWVYDGEGN EYLRCYYWAVRTLITIGGLPEPQTLFEIVFQLLNFFSGVFVFSSLIGQMRDVIGAATA NQNYFRACMDDTIAYMNNYSIPKLVQKRVRTWYEYTWDSQRMLDESDLLKTLPTTVQL ALAIDVNFSIISKVDLFKGCDTQMIYDMLLRLKSVLYLPGDFVCKKGEIGKEMYIIKH GEVQVLGGPDGTKVLVTLKAGSVFGEISLLAAGGGNRRTANVVAHGFANLLTLDKKTL QEILVHYPDSERILMKKARVLLKQKAKTAEATPPRKDLALLFPPKEETPKLFKTLLGG TGKASLARLLKLKREQAAQKKENSEGGEEEGKENEDKQKENEDKQKENEDKGKENEDK DKGREPEEKPLDRPECTASPIAVEEEPHSVRRTVLPRGTSRQSLIISMAPSAEGGEEV LTIEVKEKAKQ"
Slide 8 - Mutation… The genetic basis for achromatopsia is found on chromosome 8 (location 8q21-q22) where there is a recessive point mutation in CNGB3 that changes serine at residue 435 to phenylalanine in a highly conserved site in the S6 membrane-spanning domain.
Slide 9 - Bibliography Bookshelf: Samir S Deeb, PhD, Arno G Motulsky, MD, “Red-Green Color Vision Defects,” GeneReviews, September 19, 2005. Berg, Jeremy M. “32.3.5. Rearrangements in the Genes for the Green and Red Pigments Lead to ‘Color Blindness,’” Biochemistry 5th edition, W.H. Freeman and Company, 2002. OMIM: “COLORBLINDNESS, PARTIAL, DEUTAN SERIES; CBD” OMIM ID: 303800 PubMed: Harrison, R.; Hoefnagel, D.; Hayward, J. N. “Congenital total color blindness.” Arch. Ophthal. 64: 685-692, 1960. PubMed ID: 13711836 Botstein, D. “The molecular biology of color vision.” (Editorial) Science 232: 142-143, 1986. PubMed ID: 2937146 Reyniers, E.; Van Thienen, M.-N.; Meire, F.; De Boulle, K.; Devries, K.; Kestelijn, P.; Willems, P. J. “Gene conversion between red and defective green opsin gene in blue cone monochromacy.” Genomics 29: 323-328, 1995. PubMed ID: 8666378 Winderickx, J.; Sanocki, E.; Lindsey, D. T.; Teller, D. Y.; Motulsky, A. G.; Deeb, S. S. : “Defective colour vision associated with a missense mutation in the human green visual pigment gene.” Nature Genet. 1: 251-256, 1992. PubMed ID: 1302020
 

Frequently Asked Questions

> About SlidesFinder?

Slidesfinder is a website that allows users to upload and share their PowerPoint presentations online. It provides a platform for individuals and businesses to share their ideas and knowledge through presentations, and for others to view and download these presentations for educational or professional purposes.
Slidesfinder offers a wide range of presentation topics and categories, including business, education, science, technology, health, and more. Users can also search for presentations using keywords, tags, or by category. The website provides tools to create professional presentations with rich media, animations, and graphics.



One of the key features of Slidesfinder is its user-friendly interface, which allows users to easily upload, view, and share presentations. Users can also embed their presentations in their websites or blogs using the website's embed code feature.
Slidesfinder also offers premium services, such as the ability to create private presentations and to download presentations in high-quality formats. However, the basic features of Slidesfinder are free to use, making it accessible to anyone who wants to share their ideas and knowledge through presentations.

> How do I register with SlidesFinder?

Go to registration page (you can see signup link on top of website page) https://www.slidesfinder.com/signup . If you have facebook/gmail account them just click on SIGN IN WITH FACEBOOK OR SIGN IN WITH GOOGLE button, by this you will be a registered member of slidesfinder without filling any form, required detail automatically will be fatch from your account. If you do not a Facebook account, then click on "Signup". Fill all required fields and you will be a registered member of slidesfinder.

> Is slidesfinder account confirmation is mandatory?

Yes it is mandetory to active your account to login.

> Do I need to signup/login on SlidesFinder before uploading a PowerPoint presentation?

Yes, you need to login with your account before uploading presentation. Your username will be displayed on your uploaded presentation. Your registered email id is needed for sending your stats of uploaded presentation.

Slidesfinder is a sharing website for PowerPoint presentations search and share. Find your interest in the form of powerpoint presentations on slidesfinder and save your valuable time . On Slidesfinder you get presentations from our huge library of professional ppt presentations. We believe in making your search INFORMATIVE and FUN. Find your best ppt presentation from a pool of PowerPoint presentations stacked under important industry categories like business & management, heath & Wellness,eduction & training etc. We provide unique informative PowerPoint presentation for marketers, presenters and educationists. These professional PowerPoint presentations are uploaded by professionals from across numerous industry segments.These ppt presentations are available for FREE download.

Not just finding your interest, but facilitate you broadcast your interest. We have created this platform for easy sharing of PowerPoint presentations, ensuring that these presentations get maximum exposure. Create your slidesfinder account and upload PowerPoint presentations for free, share on social media platforms and BUILD YOUR CROWD WITH PRESENTATION !!

The Great Buddha says, "Share your knowledge.It’s a way to achieve immortality"! So, start sharing knowledge and we are here to make that immortal !!

© 2013-2022 SlidesFinder. All rights reserved.

Re-productivity of content are not allowed. Without prior written permission from author, commercial use of any content is illegal.